Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetExcitatory amino acid transporter 2
LigandBDBM50292991
Substrate/Competitorn/a
Meas. Tech.ChEMBL_496043
IC50>100000±n/a nM
Citation Jensen, AAErichsen, MNNielsen, CWStensbøl, TBKehler, JBunch, L Discovery of the first selective inhibitor of excitatory amino acid transporter subtype 1. J Med Chem52:912-5 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Excitatory amino acid transporter 2
Name:Excitatory amino acid transporter 2
Synonyms:EAAT2 | GLT1 | Glutamate/aspartate transporter II | SLC1A2 | Sodium-dependent glutamate/aspartate transporter 2 | Solute carrier family 1 member 2
Type:Enzyme Catalytic Domain
Mol. Mass.:62103.57
Organism:Homo sapiens (Human)
Description:Excitatory Amino Acid EAAT2 0 0::P43004
Residue:574
Sequence:
MASTEGANNMPKQVEVRMHDSHLGSEEPKHRHLGLRLCDKLGKNLLLTLTVFGVILGAVC
GGLLRLASPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRA
MVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENL
VQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGM
NVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKI
IAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALG
TASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVL
DGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTS
VNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYA
AHNSVIVDECKVTLAANGKSADCSVEEEPWKREK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50292991
NameBDBM50292991
Synonyms:2-amino-4-benzyl-5-oxo-7-phenyl-5,6,7,8-tetrahydro-4H-chromene-3-carbonitrile | CHEMBL474131
TypeSmall organic molecule
Emp. Form.C23H20N2O2
Mol. Mass.356.4171
SMILESN=C1OC2=C(C(Cc3ccccc3)C1C#N)C(=O)CC(C2)c1ccccc1 |c:3|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a