Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVEGF-receptor 2 and tyrosine-protein kinase SRC
LigandBDBM50162083
Substrate/Competitorn/a
Meas. Tech.ChEMBL_571642
Ki 81±n/a nM
Citation Bebbington, DBinch, HCharrier, JDEveritt, SFraysse, DGolec, JKay, DKnegtel, RMak, CMazzei, FMiller, AMortimore, MO'Donnell, MPatel, SPierard, FPinder, JPollard, JRamaya, SRobinson, DRutherford, AStudley, JWestcott, J The discovery of the potent aurora inhibitor MK-0457 (VX-680). Bioorg Med Chem Lett19:3586-92 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
VEGF-receptor 2 and tyrosine-protein kinase SRC
Name:Calmodulin/Proto-oncogene tyrosine-protein kinase Src
Synonyms:Proto-oncogene c-Src | Proto-oncogene tyrosine-protein kinase Src | Proto-oncogene tyrosine-protein kinase Src (c-Src) | SRC | Tyrosine-protein kinase Src (SRC) | V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) | c-Src | p60-Src | pp60c-src
Type:Protein
Mol. Mass.:59838.60
Organism:Homo sapiens (Human)
Description:P12931
Residue:536
Sequence:
MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50162083
NameBDBM50162083
Synonyms:(5-Methyl-1H-pyrazol-3-yl)-(2-phenyl-quinazolin-4-yl)-amine | (5-Methyl-1H-pyrazol-3-yl)-(2-phenylquinazolin-4-yl)amine | CHEMBL359482 | N-(3-methyl-1H-pyrazol-5-yl)-2-phenylquinazolin-4-amine | N-(5-METHYL-1H-PYRAZOL-3-YL)-2-PHENYLQUINAZOLIN-4-AMINE
TypeSmall organic molecule
Emp. Form.C18H15N5
Mol. Mass.301.3452
SMILESCc1cc(Nc2nc(nc3ccccc23)-c2ccccc2)[nH]n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a