Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukotriene A4 hydrolase
LigandBDBM23926
Substrate/Competitorn/a
Meas. Tech.ChEMBL_571718
IC50 366000±n/a nM
Citation Davies, DRMamat, BMagnusson, OTChristensen, JHaraldsson, MHMishra, RPease, BHansen, ESingh, JZembower, DKim, HKiselyov, ASBurgin, ABGurney, MEStewart, LJ Discovery of leukotriene A4 hydrolase inhibitors using metabolomics biased fragment crystallography. J Med Chem52:4694-715 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Leukotriene A4 hydrolase
Name:Leukotriene A4 hydrolase
Synonyms:LTA-4 hydrolase | Leukotriene A(4) hydrolase | Leukotriene A-4 hydrolase (LTA4H)
Type:Hydrolase; metalloprotease
Mol. Mass.:69280.41
Organism:Homo sapiens (Human)
Description:Human recombinant LTA4H.
Residue:611
Sequence:
MPEIVDTCSLASPASVCRTKHLHLRCSVDFTRRTLTGTAALTVQSQEDNLRSLVLDTKDL
TIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLT
PEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGETP
DPEDPSRKIYKFIQKVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETES
MLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISH
SWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLFGEKFRHFNALGGWGELQNSVKTFGET
HPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGGPEIFLGFLKAYVEKFSYKSI
TTDDWKDFLYSYFKDKVDVLNQVDWNAWLYSPGLPPIKPNYDMTLTNACIALSQRWITAK
EDDLNSFNATDLKDLSSHQLNEFLAQTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWL
RLCIQSKWEDAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAVRTYQEHKASMHPVT
AMLVGKDLKVD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23926
NameBDBM23926
Synonyms:(E)-resveratrol | 5-[(E)-2-(4-hydroxyphenyl)ethenyl]benzene-1,3-diol | CHEMBL165 | Resveratol | Stilbene, 2f | cid_445154 | resveratrol | trans-resveratrol
TypeSmall organic molecule
Emp. Form.C14H12O3
Mol. Mass.228.2433
SMILESOc1ccc(\C=C\c2cc(O)cc(O)c2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a