Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEpoxide hydratase
LigandBDBM50296191
Substrate/Competitorn/a
Meas. Tech.ChEMBL_579572
IC50 38±n/a nM
Citation Anandan, SKWebb, HKDo, ZNGless, RD Unsymmetrical non-adamantyl N,N'-diaryl urea and amide inhibitors of soluble expoxide hydrolase. Bioorg Med Chem Lett19:4259-63 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Epoxide hydratase
Name:Epoxide hydratase
Synonyms:Soluble epoxide hydrolase (sEH) | epoxide hydrolase 2, cytoplasmic
Type:Enzyme
Mol. Mass.:62613.07
Organism:Homo sapiens (Human)
Description:P34913
Residue:555
Sequence:
MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITL
SQWIPLMEENCRKCSETAKVCLPKNFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTA
ILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEV
VFLDDIGANLKPARDLGMVTILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHG
YVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESS
APPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNT
PFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMH
KVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSL
GRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIK
WLDSDARNPPVVSKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50296191
NameBDBM50296191
Synonyms:1-(3-(3-morpholinopropoxy)phenyl)-3-phenylurea | CHEMBL540430
TypeSmall organic molecule
Emp. Form.C20H25N3O3
Mol. Mass.355.4308
SMILESO=C(Nc1ccccc1)Nc1cccc(OCCCN2CCOCC2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a