Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcyl-CoA desaturase 1
LigandBDBM50296304
Substrate/Competitorn/a
Meas. Tech.ChEMBL_577393
IC50 2±n/a nM
Citation Uto, YOgata, TKiyotsuka, YMiyazawa, YUeno, YKurata, HDeguchi, TYamada, MWatanabe, NTakagi, TWakimoto, SOkuyama, RKonishi, MKurikawa, NKono, KOsumi, J Novel and potent inhibitors of stearoyl-CoA desaturase-1. Part II: Identification of 4-ethylamino-3-(2-hydroxyethoxy)-N-[5-(3-trifluoromethylbenzyl)thiazol-2-yl]benzamide and its biological evaluation. Bioorg Med Chem Lett19:4159-66 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acyl-CoA desaturase 1
Name:Acyl-CoA desaturase 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:41064.54
Organism:Mus musculus
Description:ChEMBL_1462109
Residue:355
Sequence:
MPAHMLQEISSSYTTTTTITAPPSGNEREKVKTVPLHLEEDIRPEMKEDIHDPTYQDEEG
PPPKLEYVWRNIILMVLLHLGGLYGIILVPSCKLYTCLFGIFYYMTSALGITAGAHRLWS
HRTYKARLPLRIFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGW
LLVRKHPAVKEKGGKLDMSDLKAEKLVMFQRRYYKPGLLLMCFILPTLVPWYCWGETFVN
SLFVSTFLRYTLVLNATWLVNSAAHLYGYRPYDKNIQSRENILVSLGAVGEGFHNYHHTF
PFDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKATVLARIKRTGDGSHKSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50296304
n/a
NameBDBM50296304
Synonyms:4-ethoxy-3-(2-hydroxyethoxy)-N-(5-(3-(trifluoromethyl)benzyl)thiazol-2-yl)benzamide | CHEMBL549758
TypeSmall organic molecule
Emp. Form.C22H21F3N2O4S
Mol. Mass.466.473
SMILESCCOc1ccc(cc1OCCO)C(=O)Nc1ncc(Cc2cccc(c2)C(F)(F)F)s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: