Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase AKT
LigandBDBM50297455
Substrate/Competitorn/a
Meas. Tech.ChEMBL_586027
Ki>30000±n/a nM
Citation Cao, JGao, HBemis, GSalituro, FLedeboer, MHarrington, EWilke, STaslimi, PPazhanisamy, SXie, XJacobs, MGreen, J Structure-based design and parallel synthesis of N-benzyl isatin oximes as JNK3 MAP kinase inhibitors. Bioorg Med Chem Lett19:2891-5 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase AKT
Name:Serine/threonine-protein kinase AKT
Synonyms:AKT3 | PKB gamma | Protein kinase Akt-3 | Protein kinase B (Akt 3) | Protein kinase B, gamma | RAC-PK-gamma | RAC-gamma serine/threonine-protein kinase | STK-2 | Serine/threonine-protein kinase AKT3
Type:Enzyme
Mol. Mass.:55769.36
Organism:Homo sapiens (human)
Description:n/a
Residue:479
Sequence:
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50297455
NameBDBM50297455
Synonyms:1-((6-fluoro-4H-benzo[d][1,3]dioxin-8-yl)methyl)-3-(hydroxyimino)-6-methylindolin-2-one | CHEMBL551140
TypeSmall organic molecule
Emp. Form.C18H15FN2O4
Mol. Mass.342.3211
SMILESCc1ccc2C(N=O)C(=O)N(Cc3cc(F)cc4COCOc34)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a