Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-Protein Phosphatase (CD45)
LigandBDBM50118762
Substrate/Competitorn/a
Meas. Tech.ChEMBL_590755
Ki 41000±n/a nM
Citation Vidovic, DSchürer, SC Knowledge-based characterization of similarity relationships in the human protein-tyrosine phosphatase family for rational inhibitor design. J Med Chem52:6649-59 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-Protein Phosphatase (CD45)
Name:Leukocyte common antigen
Synonyms:CD45 | Leukocyte common antigen | Leukocyte common antigen | Receptor-type tyrosine-protein phosphatase C | Receptor-type tyrosine-protein phosphatase C (CD45)
Type:Protein
Mol. Mass.:147241.89
Organism:Homo sapiens (Human)
Description:P08575
Residue:1304
Sequence:
MYLWLKLLAFGFAFLDTEVFVTGQSPTPSPTGLTTAKMPSVPLSSDPLPTHTTAFSPAST
FERENDFSETTTSLSPDNTSTQVSPDSLDNASAFNTTGVSSVQTPHLPTHADSQTPSAGT
DTQTFSGSAANAKLNPTPGSNAISDVPGERSTASTFPTDPVSPLTTTLSLAHHSSAALPA
RTSNTTITANTSDAYLNASETTTLSPSGSAVISTTTIATTPSKPTCDEKYANITVDYLYN
KETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKNASVSISHNSCTAPDKTLILDVPPG
VEKFQLHDCTQVEKADTTICLKWKNIETFTCDTQNITYRFQCGNMIFDNKEIKLENLEPE
HEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNF
TLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKS
APPSQVWNMTVSMTSDNSMHVKCRPPRDRNGPHERYHLEVEAGNTLVRNESHKNCDFRVK
DLQYSTDYTFKAYFHNGDYPGEPFILHHSTSYNSKALIAFLAFLIIVTSIALLVVLYKIY
DLHKKRSCNLDEQQELVERDDEKQLMNVEPIHADILLETYKRKIADEGRLFLAEFQSIPR
VFSKFPIKEARKPFNQNKNRYVDILPYDYNRVELSEINGDAGSNYINASYIDGFKEPRKY
IAAQGPRDETVDDFWRMIWEQKATVIVMVTRCEEGNRNKCAEYWPSMEEGTRAFGDVVVK
INQHKRCPDYIIQKLNIVNKKEKATGREVTHIQFTSWPDHGVPEDPHLLLKLRRRVNAFS
NFFSGPIVVHCSAGVGRTGTYIGIDAMLEGLEAENKVDVYGYVVKLRRQRCLMVQVEAQY
ILIHQALVEYNQFGETEVNLSELHPYLHNMKKRDPPSEPSPLEAEFQRLPSYRSWRTQHI
GNQEENKSKNRNSNVIPYDYNRVPLKHELEMSKESEHDSDESSDDDSDSEEPSKYINASF
IMSYWKPEVMIAAQGPLKETIGDFWQMIFQRKVKVIVMLTELKHGDQEICAQYWGEGKQT
YGDIEVDLKDTDKSSTYTLRVFELRHSKRKDSRTVYQYQYTNWSVEQLPAEPKELISMIQ
VVKQKLPQKNSSEGNKHHKSTPLLIHCRDGSQQTGIFCALLNLLESAETEEVVDIFQVVK
ALRKARPGMVSTFEQYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEVDKVKQDANCV
NPLGAPEKLPEAKEQAEGSEPTSGTEGPEHSVNGPASPALNQGS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50118762
NameBDBM50118762
Synonyms:2-(Oxalyl-amino)-4,5,6,7-tetrahydro-benzo[b]thiophene-3-carboxylic acid | 2-(carboxyformamido)-4,5,6,7-tetrahydrobenzo[b]thiophene-3-carboxylic acid | 2-oxalylamino-4,5,6,7-tetrahydrobenzo[b]thiophene-3-carboxylic acid | CHEMBL138152
TypeSmall organic molecule
Emp. Form.C11H11NO5S
Mol. Mass.269.274
SMILESOC(=O)C(=O)Nc1sc2CCCCc2c1C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a