Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysosomal alpha-glucosidase
LigandBDBM50299753
Substrate/Competitorn/a
Meas. Tech.ChEMBL_589173
IC50>1000±n/a nM
Citation Risseeuw, MDvan den Berg, RJDonker-Koopman, WEvan der Marel, GAAerts, JMOverhand, MOverkleeft, HS Synthesis and evaluation of D-gluco-pyranocyclopropyl amines as potential glucosidase inhibitors. Bioorg Med Chem Lett19:6600-3 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysosomal alpha-glucosidase
Name:Lysosomal alpha-glucosidase
Synonyms:70 kDa lysosomal alpha-glucosidase | 76 kDa lysosomal alpha-glucosidase | Acid maltase | Aglucosidase alfa
Type:PROTEIN
Mol. Mass.:105312.45
Organism:Homo sapiens
Description:ChEMBL_1506060
Residue:952
Sequence:
MGVRHPPCSHRLLAVCALVSLATAALLGHILLHDFLLVPRELSGSSPVLEETHPAHQQGA
SRPGPRDAQAHPGRPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYIPAKQGLQGA
QMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLH
FTIKDPANRRYEVPLETPHVHSRAPSPLYSVEFSEEPFGVIVRRQLDGRVLLNTTVAPLF
FADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNRDLAPTPGANLYGSHPFYLA
LEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGY
PFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDG
FRDFPAMVQELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGKV
WPGSTAFPDFTNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPNNELEN
PPYVPGVVGGTLQAATICASSHQFLSTHYNLHNLYGLTEAIASHRALVKARGTRPFVISR
STFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVR
WTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHVAG
ETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGTWYDLQTVPV
EALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQP
MALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVRVTSEGAGLQ
LQKVTVLGVATAPQQVLSNGVPVSNFTYSPDTKVLDICVSLLMGEQFLVSWC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50299753
n/a
NameBDBM50299753
Synonyms:CHEMBL584580 | N-((1S,3R,4S,5R,6R,7S)-4,5-Dihydroxy-3-(hydroxymethyl)-2-oxabicyclo[4.1.0]heptan-7-yl)butyramide
TypeSmall organic molecule
Emp. Form.C11H19NO5
Mol. Mass.245.2723
SMILESCCCC(=O)N[C@@H]1[C@H]2O[C@H](CO)[C@@H](O)[C@H](O)[C@@H]12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: