Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-glucosidase
LigandBDBM18351
Substrate/Competitorn/a
Meas. Tech.ChEMBL_589172
IC50 20±n/a nM
Citation Risseeuw, MDvan den Berg, RJDonker-Koopman, WEvan der Marel, GAAerts, JMOverhand, MOverkleeft, HS Synthesis and evaluation of D-gluco-pyranocyclopropyl amines as potential glucosidase inhibitors. Bioorg Med Chem Lett19:6600-3 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-glucosidase
Name:Beta-glucosidase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:104639.04
Organism:Homo sapiens
Description:ChEMBL_1435476
Residue:927
Sequence:
MGTQDPGNMGTGVPASEQISCAKEDPQVYCPEETGGTKDVQVTDCKSPEDSRPPKETDCC
NPEDSGQLMVSYEGKAMGYQVPPFGWRICLAHEFTEKRKPFQANNVSLSNMIKHIGMGLR
YLQWWYRKTHVEKKTPFIDMINSVPLRQIYGCPLGGIGGGTITRGWRGQFCRWQLNPGMY
QHRTVIADQFTVCLRREGQTVYQQVLSLERPSVLRSWNWGLCGYFAFYHALYPRAWTVYQ
LPGQNVTLTCRQITPILPHDYQDSSLPVGVFVWDVENEGDEALDVSIMFSMRNGLGGGDD
APGGLWNEPFCLERSGETVRGLLLHHPTLPNPYTMAVAARVTAATTVTHITAFDPDSTGQ
QVWQDLLQDGQLDSPTGQSTPTQKGVGIAGAVCVSSKLRPRGQCRLEFSLAWDMPRIMFG
AKGQVHYRRYTRFFGQDGDAAPALSHYALCRYAEWEERISAWQSPVLDDRSLPAWYKSAL
FNELYFLADGGTVWLEVLEDSLPEELGRNMCHLRPTLRDYGRFGYLEGQEYRMYNTYDVH
FYASFALIMLWPKLELSLQYDMALATLREDLTRRRYLMSGVMAPVKRRNVIPHDIGDPDD
EPWLRVNAYLIHDTADWKDLNLKFVLQVYRDYYLTGDQNFLKDMWPVCLAVMESEMKFDK
DHDGLIENGGYADQTYDGWVTTGPSAYCGGLWLAAVAVMVQMAALCGAQDIQDKFSSILS
RGQEAYERLLWNGRYYNYDSSSRPQSRSVMSDQCAGQWFLKACGLGEGDTEVFPTQHVVR
ALQTIFELNVQAFAGGAMGAVNGMQPHGVPDKSSVQSDEVWVGVVYGLAATMIQEGLTWE
GFQTAEGCYRTVWERLGLAFQTPEAYCQQRVFRSLAYMRPLSIWAMQLALQQQQHKKASW
PKVKQGTGLRTGPMFGPKEAMANLSPE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM18351
n/a
NameBDBM18351
Synonyms:(2R,3R,4R,5S)-2-(Hydroxymethyl)piperidine-3,4,5-triol, 10 | (2R,3R,4R,5S)-2-(hydroxymethyl)piperidine-3,4,5-triol | 1-Deoxynojirimycin | 1-deoxynojirimycin (DNJ) | CHEMBL307429 | US9181184, 1 | dNM
Typenatural product
Emp. Form.C6H13NO4
Mol. Mass.163.1717
SMILESOC[C@H]1NC[C@H](O)[C@@H](O)[C@@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: