Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin (5-HT) receptor
LigandBDBM21393
Substrate/Competitorn/a
Meas. Tech.ChEMBL_594165
Ki 0.8±n/a nM
Citation Frecentese, FFiorino, FPerissutti, ESeverino, BMagli, EEsposito, ADe Angelis, FMassarelli, PNencini, CViti, BSantagada, VCaliendo, G Efficient microwave combinatorial synthesis of novel indolic arylpiperazine derivatives as serotoninergic ligands. Eur J Med Chem45:752-9 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin (5-HT) receptor
Name:Serotonin 1 (5-HT1) receptor
Synonyms:5-HT-1A | 5-HT1 | 5-HT1A | 5-Hydroxytryptamine receptor 1A (5-HT1A) | 5-hydroxytryptamine receptor 1A | 5-hydroxytryptamine receptor 1A (5HT1A) | G-21 | Serotonin 1a (5-HT1a) receptor/Adrenergic receptor alpha-1 | Serotonin receptor 1A
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:46445.29
Organism:Rattus norvegicus (rat)
Description:Binding assays were performed using rat hippocampal membranes.
Residue:422
Sequence:
MDVFSFGQGNNTTASQEPFGTGGNVTSISDVTFSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVRKVEKKGAGT
SLGTSSAPPPKKSLNGQPGSGDWRRCAENRAVGTPCTNGAVRQGDDEATLEVIEVHRVGN
SKEHLPLPSESGSNSYAPACLERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPALLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21393
NameBDBM21393
Synonyms:7-(dipropylamino)-5,6,7,8-tetrahydronaphthalen-1-ol | 8-Hydroxy-2-(di-n-propylamino)tetralin | 8-OH-DPAT | 8-OH-DPAT,(+) | 8-OH-DPAT,(-) | 8-hydroxy-N,N-dipropylaminotetralin | CHEMBL1788118 | CHEMBL505765 | CHEMBL56 | DPAT | [3H]-8-OH-DPAT | cid_1220
Typeradiolabeled ligand
Emp. Form.C16H25NO
Mol. Mass.247.3758
SMILESCCCN(CCC)C1CCc2cccc(O)c2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a