Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTGF-beta receptor type-1
LigandBDBM50148669
Substrate/Competitorn/a
Meas. Tech.ChEMBL_598612
IC50 1320±n/a nM
Citation Ren, JXLi, LLZou, JYang, LYang, JLYang, SY Pharmacophore modeling and virtual screening for the discovery of new transforming growth factor-beta type I receptor (ALK5) inhibitors. Eur J Med Chem44:4259-65 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
TGF-beta receptor type-1
Name:TGF-beta receptor type-1
Synonyms:ALK-5 | ALK5 | Activin A receptor type II-like protein kinase of 53kD | Activin receptor-like kinase 5 | SKR4 | Serine/threonine-protein kinase receptor R4 | TGF-beta receptor type I | TGF-beta type I receptor | TGFBR1 | TGFR-1 | TbetaR-I | Transforming growth factor-beta receptor type I
Type:enzyme
Mol. Mass.:55968.24
Organism:Homo sapiens (Human)
Description:P36897
Residue:503
Sequence:
MEAAVAAPRPRLLLLVLAAAAAAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTE
TTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPG
LGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDL
IYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREER
SWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVE
GMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDS
ATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGI
HEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGA
ARLTALRIKKTLSQLSQQEGIKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50148669
NameBDBM50148669
Synonyms:3-(4-FLUOROPHENYL)-2-(6-METHYLPYRIDIN-2-YL)-5,6-DIHYDRO-4H-PYRROLO[1,2-B]PYRAZOLE | 3-(4-Fluoro-phenyl)-2-(6-methyl-pyridin-2-yl)-5,6-dihydro-4H-pyrrolo[1,2-b]pyrazole | CHEMBL121790
TypeSmall organic molecule
Emp. Form.C18H16FN3
Mol. Mass.293.3381
SMILESCc1cccc(n1)-c1nn2CCCc2c1-c1ccc(F)cc1
Structure
n/a