Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50301311
Substrate/Competitorn/a
Meas. Tech.ChEMBL_599308
Ki 2.3±n/a nM
Citation Worm, KWeaver, DGGreen, RCSaeui, CTDulay, DMBarker, WMCassel, JAStabley, GJDeHaven, RNLaBuda, CJKoblish, MBrogdon, BLSmith, SADolle, RE Discovery of N-(3-(morpholinomethyl)-phenyl)-amides as potent and selective CB2 agonists. Bioorg Med Chem Lett19:5004-8 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50301311
NameBDBM50301311
Synonyms:(+/-)3,3,3-trifluoro-2-methyl-N-(8-morpholino-5,6,7,8-tetrahydronaphthalen-2-yl)-2-(trifluoromethyl)propanamide | 3,3,3-trifluoro-2-methyl-N-(8-morpholino-5,6,7,8-tetrahydronaphthalen-2-yl)-2-(trifluoromethyl)propanamide | CHEMBL567594
TypeSmall organic molecule
Emp. Form.C19H22F6N2O2
Mol. Mass.424.3806
SMILESCC(C(=O)Nc1ccc2CCCC(N3CCOCC3)c2c1)(C(F)(F)F)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a