Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetUrokinase-type plasminogen activator
LigandBDBM50301977
Substrate/Competitorn/a
Meas. Tech.ChEMBL_599341
IC50 220±n/a nM
Citation West, CWAdler, MArnaiz, DChen, DChu, KGualtieri, GHo, EHuwe, CLight, DPhillips, GPulk, RSukovich, DWhitlow, MYuan, SBryant, J Identification of orally bioavailable, non-amidine inhibitors of Urokinase Plasminogen Activator (uPA). Bioorg Med Chem Lett19:5712-5 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Urokinase-type plasminogen activator
Name:Urokinase-type plasminogen activator/surface receptor
Synonyms:U-plasminogen activator | Urokinase | Urokinase-type plasminogen activator (uPA)
Type:Enzyme
Mol. Mass.:48528.62
Organism:Homo sapiens (Human)
Description:P00749
Residue:431
Sequence:
MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQ
HCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHN
YCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKII
GGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLG
RSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICL
PSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKML
CAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR
SHTKEENGLAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50301977
NameBDBM50301977
Synonyms:2-(6-(3'-(aminomethyl)biphenyl-3-yloxy)-3,5-difluoropyridin-2-yloxy)-4-methoxybenzoic acid | CHEMBL570696
TypeSmall organic molecule
Emp. Form.C26H20F2N2O5
Mol. Mass.478.4442
SMILESCOc1ccc(C(O)=O)c(Oc2nc(Oc3cccc(c3)-c3cccc(CN)c3)c(F)cc2F)c1
Structure
n/a