Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50304919
Substrate/Competitorn/a
Meas. Tech.ChEMBL_606628
Ki 1.1±n/a nM
Citation Sellitto, ILe Bourdonnec, BWorm, KGoodman, ASavolainen, MAChu, GHAjello, CWSaeui, CTLeister, LKCassel, JADehaven, RNLabuda, CJKoblish, MLittle, PJBrogdon, BLSmith, SADolle, RE Novel sulfamoyl benzamides as selective CB(2) agonists with improved in vitro metabolic stability. Bioorg Med Chem Lett20:387-91 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50304919
NameBDBM50304919
Synonyms:CHEMBL595268 | N-(3,4-dimethyl-5-(morpholinosulfonyl)phenyl)-2,2-dimethylhexanamide
TypeSmall organic molecule
Emp. Form.C20H32N2O4S
Mol. Mass.396.544
SMILESCCCCC(C)(C)C(=O)Nc1cc(C)c(C)c(c1)S(=O)(=O)N1CCOCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a