Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetATP-binding cassette sub-family G member 2
LigandBDBM5447
Substrate/Competitorn/a
Meas. Tech.ChEMBL_603046
IC50 1260±n/a nM
Citation Pick, AMüller, HWiese, M Novel lead for potent inhibitors of breast cancer resistance protein (BCRP). Bioorg Med Chem Lett20:180-3 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
ATP-binding cassette sub-family G member 2
Name:ATP-binding cassette sub-family G member 2
Synonyms:ABCP | ATP-Binding Cassette Transporter ABCG2 | ATP-binding cassette sub-family G member 2 | ATP-binding cassette transporter (ABCG2) | ATP-binding cassette, sub-family G, member 2 | BCRP | BCRP1 | Breast cancer resistance protein | CDw338 | MXR | Mitoxantrone resistance-associated protein | Placenta-specific ATP-binding cassette transporter | Urate exporter
Type:Multi-pass membrane protein; monomer or homodimer; disulfide-linked
Mol. Mass.:72329.48
Organism:Homo sapiens (Human)
Description:Q9UNQ0
Residue:655
Sequence:
MSSSNVEVFIPVSQGNTNGFPATASNDLKAFTEGAVLSFHNICYRVKLKSGFLPCRKPVE
KEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPSGLSGDVLINGAPRPANFKCN
SGYVVQDDVVMGTLTVRENLQFSAALRLATTMTNHEKNERINRVIQELGLDKVADSKVGT
QFIRGVSGGERKRTSIGMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIF
SIHQPRYSIFKLFDSLTLLASGRLMFHGPAQEALGYFESAGYHCEAYNNPADFFLDIING
DSTAVALNREEDFKATEIIEPSKQDKPLIEKLAEIYVNSSFYKETKAELHQLSGGEKKKK
ITVFKEISYTTSFCHQLRWVSKRSFKNLLGNPQASIAQIIVTVVLGLVIGAIYFGLKNDS
TGIQNRAGVLFFLTTNQCFSSVSAVELFVVEKKLFIHEYISGYYRVSSYFLGKLLSDLLP
MRMLPSIIFTCIVYFMLGLKPKADAFFVMMFTLMMVAYSASSMALAIAAGQSVVSVATLL
MTICFVFMMIFSGLLVNLTTIASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGN
NPCNYATCTGEEYLVKQGIDLSPWGLWKNHVALACMIVIFLTIAYLKLLFLKKYS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM5447
NameBDBM5447
Synonyms:CHEMBL939 | GEFITINIB | Iressa | N-(3-Chloro-4-fluorophenyl)-7-methoxy-6-[3-(4-morpholinyl)propoxy]-4-quinazolinamine | N-(3-chloro-4-fluorophenyl)-7-methoxy-6-[3-(morpholin-4-yl)propoxy]quinazolin-4-amine | US10106508, Gefitinib | US9416123, Gefitinib | US9730934, Gefitinib | ZD1839 | cid_123631
TypeSmall organic molecule
Emp. Form.C22H24ClFN4O3
Mol. Mass.446.902
SMILESCOc1cc2ncnc(Nc3ccc(F)c(Cl)c3)c2cc1OCCCN1CCOCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a