Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOxysterols receptor LXR-alpha
LigandBDBM50306066
Substrate/Competitorn/a
Meas. Tech.ChEMBL_605982
IC50 38±n/a nM
Citation Travins, JMBernotas, RCKaufman, DHQuinet, ENambi, PFeingold, IHuselton, CWilhelmsson, AGoos-Nilsson, AWrobel, J 1-(3-Aryloxyaryl)benzimidazole sulfones are liver X receptor agonists. Bioorg Med Chem Lett20:526-30 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Oxysterols receptor LXR-alpha
Name:Oxysterols receptor LXR-alpha
Synonyms:Liver X Receptor alpha (LXR-alpha) | Liver X receptor alpha | Liver X receptor alpha (LXRA) | Liver X receptor alpha (NR1H3) | Liver X, LXR alpha | Nuclear orphan receptor LXR-alpha | Nuclear receptor subfamily 1 group H member 3
Type:Receptor
Mol. Mass.:50403.85
Organism:Homo sapiens (Human)
Description:His-tagged hLXR.
Residue:447
Sequence:
MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEA
AEPTALLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKG
FFRRSVIKGAHYICHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLK
RQEEEQAHATSLPPRASSPPQILPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPM
APDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLL
ETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLI
AISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV
HSEQVFALRLQDKKLPPLLSEIWDVHE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50306066
NameBDBM50306066
Synonyms:1-(3-(3-(ethylsulfonyl)-5-fluorophenoxy)phenyl)-2-methyl-4-(trifluoromethyl)-1H-benzo[d]imidazole | CHEMBL594984
TypeSmall organic molecule
Emp. Form.C23H18F4N2O3S
Mol. Mass.478.459
SMILESCCS(=O)(=O)c1cc(F)cc(Oc2cccc(c2)-n2c(C)nc3c(cccc23)C(F)(F)F)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a