Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman diphtheria toxin-like ADP-ribosyltransferase (ARTD3 or PARP3)
LigandBDBM50306253
Substrate/Competitorn/a
Meas. Tech.ChEMBL_607027
IC50 50±n/a nM
Citation Torrisi, CBisbocci, MIngenito, ROntoria, JMRowley, MSchultz-Fademrecht, CToniatti, CJones, P Discovery and SAR of novel, potent and selective hexahydrobenzonaphthyridinone inhibitors of poly(ADP-ribose)polymerase-1 (PARP-1). Bioorg Med Chem Lett20:448-52 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human diphtheria toxin-like ADP-ribosyltransferase (ARTD3 or PARP3)
Name:Human diphtheria toxin-like ADP-ribosyltransferase (ARTD3 or PARP3)
Synonyms:(ARTD3 or PARP3) | ADP-ribosyltransferase diphtheria toxin-like 3 | Poly [ADP-ribose] polymerase 3 | Poly [ADP-ribose] polymerase 3 (PARP-3) | Poly(ADP-ribose) polymerase-3 (ARTD3/PARP3)
Type:PROTEIN
Mol. Mass.:60071.85
Organism:Homo sapiens
Description:n/a
Residue:533
Sequence:
MAPKPKPWVQTEGPEKKKGRQAGREEDPFRSTAEALKAIPAEKRIIRVDPTCPLSSNPGT
QVYEDYNCTLNQTNIENNNNKFYIIQLLQDSNRFFTCWNHWGRVGEVGQSKINHFTRLED
AKKDFEKKFREKTKNNWAERDHFVSHPGKYTLIEVQAEDEAQEAVVKVDRGPVRTVTKRV
QPCSLDPATQKLITNIFSKEMFKNTMALMDLDVKKMPLGKLSKQQIARGFEALEALEEAL
KGPTDGGQSLEELSSHFYTVIPHNFGHSQPPPINSPELLQAKKDMLLVLADIELAQALQA
VSEQEKTVEEVPHPLDRDYQLLKCQLQLLDSGAPEYKVIQTYLEQTGSNHRCPTLQHIWK
VNQEGEEDRFQAHSKLGNRKLLWHGTNMAVVAAILTSGLRIMPHSGGRVGKGIYFASENS
KSAGYVIGMKCGAHHVGYMFLGEVALGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPT
QDTELELDGQQVVVPQGQPVPCPEFSSSTFSQSEYLIYQESQCRLRYLLEVHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50306253
NameBDBM50306253
Synonyms:1-(2-(pyridin-3-yl)acetyl)-2,3,9,9a-tetrahydro-1H-benzo[de][1,7]naphthyridin-7(8H)-one | CHEMBL595018
TypeSmall organic molecule
Emp. Form.C18H17N3O2
Mol. Mass.307.3465
SMILESO=C(Cc1cccnc1)N1CCc2cccc3C(=O)NCC1c23
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a