Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A2a
LigandBDBM50309481
Substrate/Competitorn/a
Meas. Tech.ChEMBL_609497
IC50 2.7±n/a nM
Citation Beattie, DBrearley, ABrown, ZCharlton, SJCox, BFairhurst, RAFozard, JRGedeck, PKirkham, PMeja, KNanson, LNeef, JOakman, HSpooner, GTaylor, RJTurner, RJWest, RWoodward, H Synthesis and evaluation of two series of 4'-aza-carbocyclic nucleosides as adenosine A2A receptor agonists. Bioorg Med Chem Lett20:1219-24 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A2a
Name:Adenosine receptor
Synonyms:A2A adenosine receptor (hA2A) | ADENOSINE A2 | ADENOSINE A2a | ADORA2 | ADORA2A | Adenosine A2A receptor (A2AAR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44716.46
Organism:Homo sapiens (human)
Description:Expressed in CHO cells
Residue:412
Sequence:
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI
PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR
AKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYF
NFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR
KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNG
YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50309481
NameBDBM50309481
Synonyms:CHEMBL592541 | N-((2S,3S,4R,5R)-5-(2-(2-(1-ethyl-1H-imidazol-4-yl)ethylamino)-6-(pentan-3-ylamino)-9H-purin-9-yl)-3,4-dihydroxytetrahydrofuran-2-yl)propionamide
TypeSmall organic molecule
Emp. Form.C25H39N9O3
Mol. Mass.513.6357
SMILESCCC(CC)Nc1nc(NCCc2cn(CC)cn2)nc2n(cnc12)[C@@H]1C[C@H](NC(=O)CC)[C@@H](O)[C@H]1O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a