Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFatty acid binding protein muscle
LigandBDBM50310988
Substrate/Competitorn/a
Meas. Tech.ChEMBL_619183
Ki 9070±n/a nM
Citation Hertzel, AVHellberg, KReynolds, JMKruse, ACJuhlmann, BESmith, AJSanders, MAOhlendorf, DHSuttles, JBernlohr, DA Identification and characterization of a small molecule inhibitor of Fatty Acid binding proteins. J Med Chem52:6024-31 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Fatty acid binding protein muscle
Name:Fatty acid binding protein muscle
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:14858.36
Organism:Homo sapiens (Human)
Description:ChEMBL_1463784
Residue:133
Sequence:
MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKN
TEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTH
GTAVCTRTYEKEA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50310988
NameBDBM50310988
Synonyms:4-{[2-(methoxycarbonyl)-5-(2-thienyl)-3-thienyl]amino}-4-oxo-2-butenoic acid | 4-{[2-methoxycarbonyl)-5-(2-thienyl)-3-thienyl]amino}-4-oxo-2-butenoic acid | CHEMBL1077990
TypeSmall organic molecule
Emp. Form.C14H11NO5S2
Mol. Mass.337.371
SMILESCOC(=O)c1sc(cc1NC(=O)\C=C\C(O)=O)-c1cccs1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a