Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysosomal alpha-glucosidase
LigandBDBM50312526
Substrate/Competitorn/a
Meas. Tech.ChEMBL_617535
IC50>1000000±n/a nM
Citation Wennekes, TMeijer, AJGroen, AKBoot, RGGroener, JEvan Eijk, MOttenhoff, RBijl, NGhauharali, KSong, HO'Shea, TJLiu, HYew, NCopeland, Dvan den Berg, RJvan der Marel, GAOverkleeft, HSAerts, JM Dual-action lipophilic iminosugar improves glycemic control in obese rodents by reduction of visceral glycosphingolipids and buffering of carbohydrate assimilation. J Med Chem53:689-98 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysosomal alpha-glucosidase
Name:Lysosomal alpha-glucosidase
Synonyms:70 kDa lysosomal alpha-glucosidase | 76 kDa lysosomal alpha-glucosidase | Acid maltase | Aglucosidase alfa
Type:PROTEIN
Mol. Mass.:105312.45
Organism:Homo sapiens
Description:ChEMBL_1506060
Residue:952
Sequence:
MGVRHPPCSHRLLAVCALVSLATAALLGHILLHDFLLVPRELSGSSPVLEETHPAHQQGA
SRPGPRDAQAHPGRPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYIPAKQGLQGA
QMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLH
FTIKDPANRRYEVPLETPHVHSRAPSPLYSVEFSEEPFGVIVRRQLDGRVLLNTTVAPLF
FADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNRDLAPTPGANLYGSHPFYLA
LEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGY
PFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDG
FRDFPAMVQELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGKV
WPGSTAFPDFTNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPNNELEN
PPYVPGVVGGTLQAATICASSHQFLSTHYNLHNLYGLTEAIASHRALVKARGTRPFVISR
STFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVR
WTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHVAG
ETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGTWYDLQTVPV
EALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQP
MALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVRVTSEGAGLQ
LQKVTVLGVATAPQQVLSNGVPVSNFTYSPDTKVLDICVSLLMGEQFLVSWC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50312526
n/a
NameBDBM50312526
Synonyms:CHEMBL1076754 | N-Butyl-L-ido-1-deoxynojirimycin
TypeSmall organic molecule
Emp. Form.C10H21NO4
Mol. Mass.219.278
SMILESCCCCN1C[C@H](O)[C@@H](O)[C@H](O)[C@@H]1CO |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: