Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetStearoyl-CoA desaturase 1 (SCD1)
LigandBDBM50312702
Substrate/Competitorn/a
Meas. Tech.ChEMBL_615424
IC50 1±n/a nM
Citation Ramtohul, YKBlack, CChan, CCCrane, SGuay, JGuiral, SHuang, ZOballa, RXu, LJZhang, LLi, CS SAR and optimization of thiazole analogs as potent stearoyl-CoA desaturase inhibitors. Bioorg Med Chem Lett20:1593-7 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Stearoyl-CoA desaturase 1 (SCD1)
Name:Stearoyl-CoA desaturase 1 (SCD1)
Synonyms:Acyl-CoA desaturase 1
Type:Enzyme
Mol. Mass.:41485.97
Organism:Rattus norvegicus (Rat)
Description:P07308
Residue:358
Sequence:
MPAHMLQEISSSYTTTTTITEPPSGNLQNGREKMKKVPLYLEEDIRPEMREDIHDPSYQD
EEGPPPKLEYVWRNIILMALLHVGALYGITLIPSSKVYTLLWGIFYYLISALGITAGAHR
LWSHRTYKARLPLRIFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSH
VGWLLVRKHPAVKEKGGKLDMSDLKAEKLVMFQRRYYKPGLLLMCFILPTLVPWYCWGET
FLHSLFVSTFLRYTLVLNATWLVNSAAHLYGYRPYDKNIQSRENILVSLGAVGEGFHNYH
HAFPYDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKAAVLARIKRTGDGSHKSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50312702
n/a
NameBDBM50312702
Synonyms:(3-(2-(4-(2-(trifluoromethyl)phenoxy)piperidin-1-yl)thiazol-5-yl)-1,2,4-oxadiazol-5-yl)methanol | CHEMBL1087015
TypeSmall organic molecule
Emp. Form.C18H17F3N4O3S
Mol. Mass.426.413
SMILESOCc1nc(no1)-c1cnc(s1)N1CCC(CC1)Oc1ccccc1C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: