Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A2b
LigandBDBM50312965
Substrate/Competitorn/a
Meas. Tech.ChEMBL_616078
Ki 1±n/a nM
Citation Eastwood, PGonzalez, JParedes, SNueda, ADomenech, TAlberti, JVidal, B Discovery of N-(5,6-diarylpyridin-2-yl)amide derivatives as potent and selective A(2B) adenosine receptor antagonists. Bioorg Med Chem Lett20:1697-700 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A2b
Name:Adenosine receptors; A2b & A3
Synonyms:ADENOSINE A2B | ADORA2B | Adenosine receptor A2B (A2B)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36341.22
Organism:Homo sapiens (Human)
Description:n/a
Residue:332
Sequence:
MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFA
IPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGT
RARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMS
YMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIV
GIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYT
FHKIISRYLLCQADVKSGNGQAGVQPALGVGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50312965
NameBDBM50312965
Synonyms:CHEMBL1081812 | N-(2-(furan-2-yl)-3,4'-bipyridin-6-yl)cyclopropanecarboxamide
TypeSmall organic molecule
Emp. Form.C18H15N3O2
Mol. Mass.305.3306
SMILESO=C(Nc1ccc(-c2ccncc2)c(n1)-c1ccco1)C1CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a