Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A2b
LigandBDBM50313071
Substrate/Competitorn/a
Meas. Tech.ChEMBL_616400
Ki 1±n/a nM
Citation Eastwood, PGonzalez, JParedes, SFonquerna, SCardús, AAlonso, JANueda, ADomenech, TReinoso, RFVidal, B Discovery of potent and selective bicyclic A(2B) adenosine receptor antagonists via bioisosteric amide replacement. Bioorg Med Chem Lett20:1634-7 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A2b
Name:Adenosine receptors; A2b & A3
Synonyms:ADENOSINE A2B | ADORA2B | Adenosine receptor A2B (A2B)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36341.22
Organism:Homo sapiens (Human)
Description:n/a
Residue:332
Sequence:
MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFA
IPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGT
RARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMS
YMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIV
GIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYT
FHKIISRYLLCQADVKSGNGQAGVQPALGVGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50313071
NameBDBM50313071
Synonyms:7-(furan-2-yl)-6-(pyrimidin-4-yl)pyrido[2,3-d]pyrimidine-2,4(1H,3H)-dione | CHEMBL1080513
TypeSmall organic molecule
Emp. Form.C15H9N5O3
Mol. Mass.307.2637
SMILESO=c1[nH]c2nc(-c3ccco3)c(cc2c(=O)[nH]1)-c1ccncn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a