Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine protein kinase NLK
LigandBDBM50314070
Substrate/Competitorn/a
Meas. Tech.ChEMBL_627168
Kd 170±n/a nM
Citation Goldstein, DMKuglstatter, ALou, YSoth, MJ Selective p38alpha inhibitors clinically evaluated for the treatment of chronic inflammatory disorders. J Med Chem53:2345-53 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine protein kinase NLK
Name:Serine/threonine protein kinase NLK
Synonyms:NLK
Type:PROTEIN
Mol. Mass.:58306.88
Organism:Homo sapiens
Description:ChEMBL_774580
Residue:527
Sequence:
MSLCGARANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAA
VHPVQQHTSSAAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAAT
VKAHHHQHSHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDH
VKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQE
VVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTP
SLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKD
ALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEI
IHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50314070
NameBDBM50314070
Synonyms:6-(2,4-difluorophenoxy)-2-{[3-hydroxy-1-(2-hydroxyethyl)propyl]amino}-8-methylpyrido[2,3-d]pyrimidin-7(8H)-one | CHEMBL1090089 | pamapimod
TypeSmall organic molecule
Emp. Form.C19H20F2N4O4
Mol. Mass.406.3833
SMILESCn1c2nc(NC(CCO)CCO)ncc2cc(Oc2ccc(F)cc2F)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a