Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlutamate receptor ionotropic AMPA
LigandBDBM50316377
Substrate/Competitorn/a
Meas. Tech.ChEMBL_627999
EC50 41600±n/a nM
Citation Fleming, JJEngland, PM Developing a complete pharmacology for AMPA receptors: a perspective on subtype-selective ligands. Bioorg Med Chem18:1381-7 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glutamate receptor ionotropic AMPA
Name:Glutamate receptor ionotropic AMPA
Synonyms:AMPA-selective glutamate receptor 3 | GluR-3 | GluR-C | GluR-K3 | Glutamate receptor 3 | Glutamate receptor ionotropic, AMPA 3
Type:PROTEIN
Mol. Mass.:101172.14
Organism:Homo sapiens (Human)
Description:ChEMBL_468627
Residue:894
Sequence:
MARQKKMGQSVLRAVFFLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAFRFAVQLYNT
NQNTTEKPFHLNYHVDHLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSMNTLTSFCGAL
HTSFVTPSFPTDADVQFVIQMRPALKGAILSLLGHYKWEKFVYLYDTERGFSILQAIMEA
AVQNNWQVTARSVGNIKDVQEFRRIIEEMDRRQEKRYLIDCEVERINTILEQVVILGKHS
RGYHYMLANLGFTDILLERVMHGGANITGFQIVNNENPMVQQFIQRWVRLDEREFPEAKN
APLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQGIDIERALKM
VQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDSASS
ENRTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKY
GARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKS
KPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLEDNNEEPRDPQSPPDPP
NEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVER
MVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTAD
GVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRNAVNL
AVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMM
VALIEFCYKSRAESKRMKLTKNTQNFKPAPATNTQNYATYREGYNVYGTESVKI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50316377
NameBDBM50316377
Synonyms:(R,S)-6-(2-amino-2-carboxyethyl)-3-hydroxypyridazine 1-oxide | CHEMBL1094977
TypeSmall organic molecule
Emp. Form.C7H9N3O4
Mol. Mass.199.1641
SMILESNC(Cc1ccc(=O)[nH][n+]1[O-])C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a