Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGRIA2
LigandBDBM50316375
Substrate/Competitorn/a
Meas. Tech.ChEMBL_628115
EC50 150±n/a nM
Citation Fleming, JJEngland, PM Developing a complete pharmacology for AMPA receptors: a perspective on subtype-selective ligands. Bioorg Med Chem18:1381-7 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
GRIA2
Name:Glutamate receptor AMPA 2/3
Synonyms:AMPA-selective glutamate receptor 2 | GluR-2 | GluR-B | GluR-K2 | Glutamate AMPA 2 | Glutamate receptor 2 | Glutamate receptor ionotropic AMPA | Glutamate receptor ionotropic, AMPA 2
Type:Enzyme Catalytic Domain
Mol. Mass.:98825.96
Organism:Homo sapiens (Human)
Description:Glutamate AMPA 2 GRIA2 HUMAN::P42262
Residue:883
Sequence:
MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTP
HIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDG
THPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINV
GNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANL
GFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTTTIKYTSALT
YDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNI
KFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTT
ILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKI
WNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLD
PLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWF
SLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL
SKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGK
YAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRNAVNLAVLKLNEQGLL
DKLKNKWWYDKGECGSGGGDSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSR
AEAKRMKVAKNAQNINPSSSQNSQNFATYKEGYNVYGIESVKI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50316375
NameBDBM50316375
Synonyms:CHEMBL1097939 | LY-404187 | N-[2-(4'-cyanobiphenyl-4-yl)propyl]propane-2-sulfonamide
TypeSmall organic molecule
Emp. Form.C19H28N2O2S
Mol. Mass.348.503
SMILESCC(C)S(=O)(=O)NCC(C)C1CCC(CC1)c1ccc(cc1)C#N |(35.08,-18.3,;35.1,-19.84,;36.44,-20.59,;33.78,-20.62,;32.99,-21.94,;34.53,-21.94,;32.44,-19.86,;31.11,-20.63,;29.77,-19.86,;29.77,-18.32,;28.44,-20.63,;28.44,-22.17,;27.12,-22.94,;25.78,-22.17,;25.77,-20.64,;27.1,-19.86,;24.45,-22.95,;23.11,-22.18,;21.79,-22.95,;21.79,-24.5,;23.12,-25.27,;24.46,-24.5,;20.45,-25.27,;19.11,-26.03,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a