Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H4 receptor
LigandBDBM50319307
Substrate/Competitorn/a
Meas. Tech.ChEMBL_634017
EC50 6.9±n/a nM
Citation Savall, BMEdwards, JPVenable, JDBuzard, DJThurmond, RHack, MMcGovern, P Agonist/antagonist modulation in a series of 2-aryl benzimidazole H4 receptor ligands. Bioorg Med Chem Lett20:3367-71 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H4 receptor
Name:Histamine H4 receptor
Synonyms:AXOR35 | G-protein coupled receptor 105 | GPRv53 | HH4R | HISTAMINE H4 | Histamine H4 receptor (H4R) | Histamine receptor (H3 and H4) | Pfi-013 | SP9144
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44517.02
Organism:Homo sapiens (Human)
Description:Binding assays were using CHO cells stably expressing hH4R receptors.
Residue:390
Sequence:
MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAIS
DFFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAV
SYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSF
LEFVIPVILVAYFNMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSA
STEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR
LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPL
CHKRFQKAFLKIFCIKKQPLPSQHSRSVSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50319307
NameBDBM50319307
Synonyms:(+/-)-3-(4-(5-fluoro-4-methyl-1H-benzo[d]imidazol-2-yl)-3-methylphenoxy)-N-(piperidin-3-ylmethyl)propan-1-amine | CHEMBL1084869
TypeSmall organic molecule
Emp. Form.C24H31FN4O
Mol. Mass.410.5275
SMILESCc1cc(OCCCNCC2CCCNC2)ccc1-c1nc2ccc(F)c(C)c2[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a