Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAurora kinase B/Inner centromere protein
LigandBDBM50319623
Substrate/Competitorn/a
Meas. Tech.ChEMBL_634452
Ki 2±n/a nM
Citation Wang, SMidgley, CAScaërou, FGrabarek, JBGriffiths, GJackson, WKontopidis, GMcClue, SJMcInnes, CMeades, CMezna, MPlater, AStuart, IThomas, MPWood, GClarke, RGBlake, DGZheleva, DILane, DPJackson, RCGlover, DMFischer, PM Discovery of N-phenyl-4-(thiazol-5-yl)pyrimidin-2-amine aurora kinase inhibitors. J Med Chem53:4367-78 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aurora kinase B/Inner centromere protein
Name:Aurora kinase A/B
Synonyms:AIM-1 | Aurora B kinase (aurB) | Aurora B-INCENP | Aurora kinase 2 | Aurora kinase B | Aurora kinase B (AURKB) | Aurora-related kinase 2 | STK-1 | Serine/threonine-protein kinase aurora B
Type:Protein
Mol. Mass.:39327.72
Organism:Homo sapiens (Human)
Description:Q96GD4
Residue:344
Sequence:
MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMEN
SSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEH
QLRREIEIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATI
MEELADALMYCHGKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYL
PPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPMGA
QDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50319623
NameBDBM50319623
Synonyms:4-(2,4-Dimethylthiazol-5-yl)-N-(3,4,5-trimethoxyphenyl)pyrimidin-2-amine | CHEMBL1083151
TypeSmall organic molecule
Emp. Form.C18H20N4O3S
Mol. Mass.372.441
SMILESCOc1cc(Nc2nccc(n2)-c2sc(C)nc2C)cc(OC)c1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a