Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVasopressin V2 receptor (V2)
LigandBDBM85095
Substrate/Competitorn/a
Meas. Tech.ChEMBL_634857
Ki 0.36±n/a nM
Citation Crombie, ALAntrilli, TMCampbell, BACrandall, DLFailli, AAHe, YKern, JCMoore, WJNogle, LMTrybulski, EJ Synthesis and evaluation of azabicyclo[3.2.1]octane derivatives as potent mixed vasopressin antagonists. Bioorg Med Chem Lett20:3742-5 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Vasopressin V2 receptor (V2)
Name:Vasopressin receptor
Synonyms:AVPR V2 | AVPR2 | Antidiuretic hormone receptor | Renal-type arginine vasopressin receptor | VASOPRESSIN V2 | Vasopressin V2 receptor
Type:Receptor
Mol. Mass.:40295.28
Organism:Homo sapiens (Human)
Description:P30518
Residue:371
Sequence:
MLMASTTSAVPGHPSLPSLPSNSSQERPLDTRDPLLARAELALLSIVFVAVALSNGLVLA
ALARRGRRGHWAPIHVFIGHLCLADLAVALFQVLPQLAWKATDRFRGPDALCRAVKYLQM
VGMYASSYMILAMTLDRHRAICRPMLAYRHGSGAHWNRPVLVAWAFSLLLSLPQLFIFAQ
RNVEGGSGVTDCWACFAEPWGRRTYVTWIALMVFVAPTLGIAACQVLIFREIHASLVPGP
SERPGGRRRGRRTGSPGEGAHVSAAVAKTVRMTLVIVVVYVLCWAPFFLVQLWAAWDPEA
PLEGAPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTT
ASSSLAKDTSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85095
NameBDBM85095
Synonyms:CAS_151171 | CONIVAPTAN | NSC_151171 | YM087
TypeSmall organic molecule
Emp. Form.C32H26N4O2
Mol. Mass.498.5744
SMILESCc1nc-2c(CCN(C(=O)c3ccc(NC(=O)c4ccccc4-c4ccccc4)cc3)c3ccccc-23)[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a