Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin S
LigandBDBM50323257
Substrate/Competitorn/a
Meas. Tech.ChEMBL_643894
IC50 2.5±n/a nM
Citation Cai, JBaugh, MBlack, DLong, CJonathan Bennett, DDempster, MFradera, XGillespie, JAndrews, FBoucharens, SBruin, JCameron, KSCumming, IHamilton, WJones, PSKaptein, AKinghorn, EMaidment, MMartin, IMitchell, ARankovic, ZRobinson, JScullion, PUitdehaag, JCVink, PWestwood, Pvan Zeeland, Mvan Berkom, LBastiani, MMeulemans, T 6-Phenyl-1H-imidazo[4,5-c]pyridine-4-carbonitrile as cathepsin S inhibitors. Bioorg Med Chem Lett20:4350-4 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin S
Name:Cathepsin S
Synonyms:n/a
Type:Enzyme
Mol. Mass.:38476.67
Organism:Mus musculus (Mouse)
Description:O70370
Residue:340
Sequence:
MRAPGHAAIRWLFWMPLVCSVAMEQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIW
EKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEILCRMGALRIPRQSPKTVTFRSYSN
RTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSN
EEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLP
FGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGK
DYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50323257
NameBDBM50323257
Synonyms:1-methyl-6-(4-(pyridin-2-ylmethoxy)-3-(trifluoromethyl)phenyl)-1H-imidazo[4,5-c]pyridine-4-carbonitrile | CHEMBL1208975
TypeSmall organic molecule
Emp. Form.C21H14F3N5O
Mol. Mass.409.364
SMILESCn1cnc2c(nc(cc12)-c1ccc(OCc2ccccn2)c(c1)C(F)(F)F)C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a