Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin S
LigandBDBM50323267
Substrate/Competitorn/a
Meas. Tech.ChEMBL_643889
IC50 676±n/a nM
Citation Cai, JBaugh, MBlack, DLong, CJonathan Bennett, DDempster, MFradera, XGillespie, JAndrews, FBoucharens, SBruin, JCameron, KSCumming, IHamilton, WJones, PSKaptein, AKinghorn, EMaidment, MMartin, IMitchell, ARankovic, ZRobinson, JScullion, PUitdehaag, JCVink, PWestwood, Pvan Zeeland, Mvan Berkom, LBastiani, MMeulemans, T 6-Phenyl-1H-imidazo[4,5-c]pyridine-4-carbonitrile as cathepsin S inhibitors. Bioorg Med Chem Lett20:4350-4 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin S
Name:Cathepsin S
Synonyms:CTSS | Cathepsin S (Cat S) | cathepsin S preproprotein
Type:Protein
Mol. Mass.:37507.38
Organism:Homo sapiens (Human)
Description:P25774
Residue:331
Sequence:
MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVM
LHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVD
WREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGC
NGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKE
AVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSW
GHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50323267
NameBDBM50323267
Synonyms:6-(4-(benzyloxy)-3-(trifluoromethyl)phenyl)-1H-imidazo[4,5-c]pyridine-4-carbonitrile | CHEMBL1208845
TypeSmall organic molecule
Emp. Form.C21H13F3N4O
Mol. Mass.394.3493
SMILESFC(F)(F)c1cc(ccc1OCc1ccccc1)-c1cc2[nH]cnc2c(n1)C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a