Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-1 adrenergic receptor
LigandBDBM50324837
Substrate/Competitorn/a
Meas. Tech.ChEMBL_651476
Ki 1.7±n/a nM
Citation Beattie, DBradley, MBrearley, ACharlton, SJCuenoud, BMFairhurst, RAGedeck, PGosling, MJanus, DJones, DLewis, CMcCarthy, COakman, HStringer, RTaylor, RJTuffnell, A A physical properties based approach for the exploration of a 4-hydroxybenzothiazolone series of beta2-adrenoceptor agonists as inhaled long-acting bronchodilators. Bioorg Med Chem Lett20:5302-7 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-1 adrenergic receptor
Name:Adrenergic receptor
Synonyms:B1AR | Beta-1 adrenoceptor | Beta-1 adrenoreceptor | adrenergic Beta1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:51338.40
Organism:Homo sapiens (human)
Description:n/a
Residue:477
Sequence:
MGAGVLVLGASEPGNLSSAAPLPDGAATAARLLVPASPPASLLPPASESPEPLSQQWTAG
MGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVC
TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPVPAPAPPPGPPRPAAAAATAP
LANGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDRLFV
FFNWLGYANSAFNPIIYCRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGP
PPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50324837
n/a
NameBDBM50324837
Synonyms:(R)-7-(2-(2-(4-chlorophenylthio)ethylamino)-1-hydroxyethyl)-4-hydroxybenzo[d]thiazol-2(3H)-one | CHEMBL1221861
TypeSmall organic molecule
Emp. Form.C17H17ClN2O3S2
Mol. Mass.396.911
SMILESO[C@@H](CNCCSc1ccc(Cl)cc1)c1ccc(O)c2[nH]c(=O)sc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: