Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThrombopoietin receptor
LigandBDBM50325421
Substrate/Competitorn/a
Meas. Tech.ChEMBL_652150
EC50 44±n/a nM
Citation Tang, PCLu, HJChen, YQWang, SLZheng, HWang, L Synthesis and biological evaluation of oxoindolin-3-ylidene ethyl benzothiohydrazides as non-peptide TPO mimics. Bioorg Med Chem Lett20:5062-4 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thrombopoietin receptor
Name:Thrombopoietin receptor
Synonyms:C-mpl | CD_antigen=CD110 | Myeloproliferative leukemia protein | TPO-R
Type:PROTEIN
Mol. Mass.:71243.48
Organism:Homo sapiens
Description:ChEMBL_535587
Residue:635
Sequence:
MPSWALFMVTSCLLLAPQNLAQVSSQDVSLLASDSEPLKCFSRTFEDLTCFWDEEEAAPS
GTYQLLYAYPREKPRACPLSSQSMPHFGTRYVCQFPDQEEVRLFFPLHLWVKNVFLNQTR
TQRVLFVDSVGLPAPPSIIKAMGGSQPGELQISWEEPAPEISDFLRYELRYGPRDPKNST
GPTVIQLIATETCCPALQRPHSASALDQSPCAQPTMPWQDGPKQTSPSREASALTAEGGS
CLISGLQPGNSYWLQLRSEPDGISLGGSWGSWSLPVTVDLPGDAVALGLQCFTLDLKNVT
CQWQQQDHASSQGFFYHSRARCCPRDRYPIWENCEEEEKTNPGLQTPQFSRCHFKSRNDS
IIHILVEVTTAPGTVHSYLGSPFWIHQAVRLPTPNLHWREISSGHLELEWQHPSSWAAQE
TCYQLRYTGEGHQDWKVLEPPLGARGGTLELRPRSRYRLQLRARLNGPTYQGPWSSWSDP
TRVETATETAWISLVTALHLVLGLSAVLGLLLLRWQFPAHYRRLRHALWPSLPDLHRVLG
QYLRDTAALSPPKATVSDTCEEVEPSLLEILPKSSERTPLPLCSSQAQMDYRRLQPSCLG
TMPLSVCPPMAESGSCCTTHIANHSYLPLSYWQQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50325421
NameBDBM50325421
Synonyms:4-(2-(1-(5-fluoro-2-oxo-1-p-tolylindolin-3-ylidene)ethyl)hydrazinecarbonothioyl)benzoic acid | CHEMBL1222640
TypeSmall organic molecule
Emp. Form.C25H20FN3O3S
Mol. Mass.461.508
SMILESCC(=NNC(=S)c1ccc(cc1)C(O)=O)C1C(=O)N(c2ccc(F)cc12)c1ccc(C)cc1 |w:2.2|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a