Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRhodesain
LigandBDBM50240948
Substrate/Competitorn/a
Meas. Tech.ChEMBL_652322
Ki 5310±n/a nM
Citation Waag, TGelhaus, CRath, JStich, ALeippe, MSchirmeister, T Allicin and derivates are cysteine protease inhibitors with antiparasitic activity. Bioorg Med Chem Lett20:5541-3 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Rhodesain
Name:Rhodesain
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:48425.78
Organism:Trypanosoma brucei rhodesiense
Description:ChEMBL_619861
Residue:450
Sequence:
MPRTEMVRFVRLPVVLLAMAACLASVALGSLHVEESLEMRFAAFKKKYGKVYKDAKEEAF
RFRAFEENMEQAKIQAAANPYATFGVTPFSDMTREEFRARYRNGASYFAAAQKRLRKTVN
VTTGRAPAAVDWREKGAVTPVKDQGQCGSCWAFSTIGNIEGQWQVAGNPLVSLSEQMLVS
CDTIDFGCGGGLMDNAFNWIVNSNGGNVFTEASYPYVSGNGEQPQCQMNGHEIGAAITDH
VDLPQDEDAIAAYLAENGPLAIAVDATSFMDYNGGILTSCTSEQLDHGVLLVGYNDSSNP
PYWIIKNSWSNMWGEDGYIRIEKGTNQCLMNQAVSSAVVGGPTPPPPPPPPPSATFTQDF
CEGKGCTKGCSHATFPTGECVQTTGVGSVIATCGASNLTQIIYPLSRSCSGLSVPITVPL
DKCIPILIGSVEYHCSTNPPTKAARLVPHQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50240948
NameBDBM50240948
Synonyms:CHEMBL359965 | S-allyl prop-2-ene-1-sulfinothioate | allicin | thio-2-propene-1-sulfinic acid S-allyl ester
TypeSmall organic molecule
Emp. Form.C6H10OS2
Mol. Mass.162.273
SMILESC=CCSS(=O)CC=C
Structure
n/a