Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase Aurora-C
LigandBDBM16673
Substrate/Competitorn/a
Meas. Tech.ChEMBL_655687
Kd 210±n/a nM
Citation Zarrinkar, PPGunawardane, RNCramer, MDGardner, MFBrigham, DBelli, BKaraman, MWPratz, KWPallares, GChao, QSprankle, KGPatel, HKLevis, MArmstrong, RCJames, JBhagwat, SS AC220 is a uniquely potent and selective inhibitor of FLT3 for the treatment of acute myeloid leukemia (AML). Blood114:2984-92 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase Aurora-C
Name:Serine/threonine-protein kinase Aurora-C
Synonyms:Aurora kinase C | Aurora kinase C (AURKC) | Aurora-C | Aurora/Ipl1-related kinase 3 | Aurora/Ipl1/Eg2 protein 2 | Serine/threonine-protein kinase 13
Type:Enzyme
Mol. Mass.:35602.43
Organism:Homo sapiens (Human)
Description:Amino acid residues 1-309 were expressed as His-tagged fusion protein using baculovirus expression system.
Residue:309
Sequence:
MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLA
RLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLIL
EYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEV
KIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFE
SASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRV
LPPCAQMAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM16673
NameBDBM16673
Synonyms:4-[4-({[4-chloro-3-(trifluoromethyl)phenyl]carbamoyl}amino)phenoxy]-N-methylpyridine-2-carboxamide | 4-[4-[[4-chloro-3-(trifluoromethyl)phenyl]carbamoylamino]phenoxy]-N-methyl-picolinamide;tosylic acid | BAY 43-9006 | BAY 439006 | BAY439006 | CHEMBL1336 | Hit compound, 8 | Nexavar | Sorafenib | Sorafenib, 4 | US10183928, Sorafenib | US10202365, Compound Sorafenib | US9029401, Sorafenib | US9469639, Sorafenib | Xarelto | cid_216239
TypeSmall organic molecule
Emp. Form.C21H16ClF3N4O3
Mol. Mass.464.825
SMILESCNC(=O)c1cc(Oc2ccc(NC(=O)Nc3ccc(Cl)c(c3)C(F)(F)F)cc2)ccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a