Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAurora kinase B
LigandBDBM50326198
Substrate/Competitorn/a
Meas. Tech.ChEMBL_659351
EC50>1200±n/a nM
Citation Cee, VJSchenkel, LBHodous, BLDeak, HLNguyen, HNOlivieri, PRRomero, KBak, ABe, XBellon, SBush, TLCheng, ACChung, GCoats, SEden, PMHanestad, KGallant, PLGu, YHuang, XKendall, RLLin, MHMorrison, MJPatel, VFRadinsky, RRose, PERoss, SSun, JRTang, JZhao, HPayton, MGeuns-Meyer, SD Discovery of a potent, selective, and orally bioavailable pyridinyl-pyrimidine phthalazine aurora kinase inhibitor. J Med Chem53:6368-77 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aurora kinase B
Name:Aurora kinase B
Synonyms:AIM-1 | Aurora B kinase (aurB) | Aurora B-INCENP | Aurora kinase 2 | Aurora kinase B (AURKB) | Aurora-related kinase 2 | STK-1 | Serine/threonine-protein kinase aurora B
Type:Protein
Mol. Mass.:39327.72
Organism:Homo sapiens (Human)
Description:Q96GD4
Residue:344
Sequence:
MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMEN
SSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEH
QLRREIEIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATI
MEELADALMYCHGKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYL
PPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPMGA
QDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50326198
NameBDBM50326198
Synonyms:CHEMBL1242977 | N-(3-Methyl-4-(3-(2-(methylamino)pyrimidin-4-yl)pyridin-2-yloxy)phenyl)-3-(trifluoromethyl)benzamide
TypeSmall organic molecule
Emp. Form.C25H20F3N5O2
Mol. Mass.479.4538
SMILESCNc1nccc(n1)-c1cccnc1Oc1ccc(NC(=O)c2cccc(c2)C(F)(F)F)cc1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a