Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPotassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2
LigandBDBM50326988
Substrate/Competitorn/a
Meas. Tech.ChEMBL_663438
EC50 5450±n/a nM
Citation Melchiorre, MDel Lungo, MGuandalini, LMartini, EDei, SManetti, DScapecchi, STeodori, ESartiani, LMugelli, ACerbai, ERomanelli, MN Design, synthesis, and preliminary biological evaluation of new isoform-selective f-current blockers. J Med Chem53:6773-7 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2
Name:Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2
Synonyms:BCNG-2 | Brain cyclic nucleotide-gated channel 2 | HAC-1 | Hyperpolarization-activated cation channel 1
Type:PROTEIN
Mol. Mass.:94741.48
Organism:Mus musculus
Description:ChEMBL_663438
Residue:863
Sequence:
MDARGGGGRPGDSPGTTPAPGPPPPPPPPAPPQPQPPPAPPPNPTTPSHPESADEPGPRA
RLCSRDSACTPGAAKGGANGECGRGEPQCSPEGPARGPKVSFSCRGAASGPSAAEEAGSE
EAGPAGEPRGSQASFLQRQFGALLQPGVNKFSLRMFGSQKAVEREQERVKSAGAWIIHPY
SDFRFYWDFTMLLFMVGNLIIIPVGITFFKDETTAPWIVFNVVSDTFFLMDLVLNFRTGI
VIEDNTEIILDPEKIKKKYLRTWFVVDFVSSIPVDYIFLIVEKGIDSEVYKTARALRIVR
FTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVMRICNLISMMLLLCHWDGCLQFL
VPMLQDFPSDCWVSINNMVNHSWSELYSFALFKAMSHMLCIGYGRQAPESMTDIWLTMLS
MIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHR
YQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQP
GDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTY
CRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLHKVQHDLSSGVFNNQE
NAIIQEIVKYDREMVQQAELGQRVGLFPPPPPPQVTSAIATLQQAVAMSFCPQVARPLVG
PLALGSPRLVRRAPPGPLPPAASPGPPAASPPAAPSSPRAPRTSPYGVPGSPATRVGPAL
PARRLSRASRPLSASQPSLPHGVPAPSPAASARPASSSTPRLGPAPTARTAAPSPDRRDS
ASPGAASGLDPLDSARSRLSSNL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50326988
n/a
NameBDBM50326988
Synonyms:3-(3-{[2-(3,4-Dimethoxy-phenyl)-ethyl]-methyl-amino}-propyl)-7,8-dimethoxy-1,3,4,5-tetrahydro-benzo[d]azepin-2-one | CHEMBL69679 | Zatebradine
TypeSmall organic molecule
Emp. Form.C26H36N2O5
Mol. Mass.456.5744
SMILESCOc1ccc(CCN(C)CCCN2CCc3cc(OC)c(OC)cc3CC2=O)cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: