Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLIM domain kinase 2
LigandBDBM50327391
Substrate/Competitorn/a
Meas. Tech.ChEMBL_664472
IC50 3.05±n/a nM
Citation Lin, SWrobleski, STHynes, JPitt, SZhang, RFan, YDoweyko, AMKish, KFSack, JSMalley, MFKiefer, SENewitt, JAMcKinnon, MTrzaskos, JBarrish, JCDodd, JHSchieven, GLLeftheris, K Utilization of a nitrogen-sulfur nonbonding interaction in the design of new 2-aminothiazol-5-yl-pyrimidines as p38a MAP kinase inhibitors. Bioorg Med Chem Lett20:5864-8 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
LIM domain kinase 2
Name:LIM domain kinase 2
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:72238.81
Organism:Homo sapiens (Human)
Description:ChEMBL_1514398
Residue:638
Sequence:
MSALAGEDVWRCPGCGDHIAPSQIWYRTVNETWHGSCFRCSECQDSLTNWYYEKDGKLYC
PKDYWGKFGEFCHGCSLLMTGPFMVAGEFKYHPECFACMSCKVIIEDGDAYALVQHATLY
CGKCHNEVVLAPMFERLSTESVQEQLPYSVTLISMPATTEGRRGFSVSVESACSNYATTV
QVKEVNRMHISPNNRNAIHPGDRILEINGTPVRTLRVEEVEDAISQTSQTLQLLIEHDPV
SQRLDQLRLEARLAPHMQNAGHPHALSTLDTKENLEGTLRRRSLRRSNSISKSPGPSSPK
EPLLFSRDISRSESLRCSSSYSQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMK
ELIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRSM
DPFPWQQKVRFAKGIASGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRLIVEER
KRAPMEKATTKKRTLRKNDRKKRYTVVGNPYWMAPEMLNGKSYDETVDIFSFGIVLCEII
GQVYADPDCLPRTLDFGLNVKLFWEKFVPTDCPPAFFPLAAICCRLEPESRPAFSKLEDS
FEALSLYLGELGIPLPAELEELDHTVSMQYGLTRDSPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50327391
NameBDBM50327391
Synonyms:CHEMBL1258976 | N1-(4-(2-chlorophenyl)-6-(2-(isopropylamino)thiazol-5-yl)pyrimidin-2-yl)-N2,N2-dimethylethane-1,2-diamine
TypeSmall organic molecule
Emp. Form.C20H25ClN6S
Mol. Mass.416.971
SMILESCC(C)Nc1ncc(s1)-c1cc(nc(NCCN(C)C)n1)-c1ccccc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a