Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBifunctional epoxide hydrolase 2
LigandBDBM50327846
Substrate/Competitorn/a
Meas. Tech.ChEMBL_664906
IC50 0.4±n/a nM
Citation Rose, TEMorisseau, CLiu, JYInceoglu, BJones, PDSanborn, JRHammock, BD 1-Aryl-3-(1-acylpiperidin-4-yl)urea inhibitors of human and murine soluble epoxide hydrolase: structure-activity relationships, pharmacokinetics, and reduction of inflammatory pain. J Med Chem53:7067-75 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bifunctional epoxide hydrolase 2
Name:Bifunctional epoxide hydrolase 2
Synonyms:Epoxide hydratase | Soluble epoxide hydrolase (sEH)
Type:Enzyme
Mol. Mass.:62512.06
Organism:Mus musculus (Mouse)
Description:P34914
Residue:554
Sequence:
MALRVAAFDLDGVLALPSIAGAFRRSEEALALPRDFLLGAYQTEFPEGPTEQLMKGKITF
SQWVPLMDESYRKSSKACGANLPENFSISQIFSQAMAARSINRPMLQAAIALKKKGFTTC
IVTNNWLDDGDKRDSLAQMMCELSQHFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEV
VFLDDFGSNLKPARDMGMVTILVHNTASALRELEKVTGTQFPEAPLPVPCNPNDVSHGYV
TVKPGIRLHFVEMGSGPALCLCHGFPESWFSWRYQIPALAQAGFRVLAIDMKGYGDSSSP
PEIEEYAMELLCKEMVTFLDKLGIPQAVFIGHDWAGVMVWNMALFYPERVRAVASLNTPF
MPPDPDVSPMKVIRSIPVFNYQLYFQEPGVAEAELEKNMSRTFKSFFRASDETGFIAVHK
ATEIGGILVNTPEDPNLSKITTEEEIEFYIQQFKKTGFRGPLNWYRNTERNWKWSCKGLG
RKILVPALMVTAEKDIVLRPEMSKNMEKWIPFLKRGHIEDCGHWTQIEKPTEVNQILIKW
LQTEVQNPSVTSKI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50327846
NameBDBM50327846
Synonyms:1-(1-(Cyclopropanecarbonyl)piperidin-4-yl)-3-(4-(trifluoromethoxy)phenyl)urea | CHEMBL1257405 | US10383835, Compound 2214 | US9296693, 52
TypeSmall organic molecule
Emp. Form.C17H20F3N3O3
Mol. Mass.371.3542
SMILESFC(F)(F)Oc1ccc(NC(=O)NC2CCN(CC2)C(=O)C2CC2)cc1
Structure
n/a