Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetExcitatory amino acid transporter 2
LigandBDBM50004899
Substrate/Competitorn/a
Meas. Tech.ChEMBL_664973
IC50 4000±n/a nM
Citation Luethi, ENguyen, KTBürzle, MBlum, LCSuzuki, YHediger, MReymond, JL Identification of selective norbornane-type aspartate analogue inhibitors of the glutamate transporter 1 (GLT-1) from the chemical universe generated database (GDB). J Med Chem53:7236-50 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Excitatory amino acid transporter 2
Name:Excitatory amino acid transporter 2
Synonyms:EAAT2 | GLT1 | Glutamate/aspartate transporter II | SLC1A2 | Sodium-dependent glutamate/aspartate transporter 2 | Solute carrier family 1 member 2
Type:Enzyme Catalytic Domain
Mol. Mass.:62103.57
Organism:Homo sapiens (Human)
Description:Excitatory Amino Acid EAAT2 0 0::P43004
Residue:574
Sequence:
MASTEGANNMPKQVEVRMHDSHLGSEEPKHRHLGLRLCDKLGKNLLLTLTVFGVILGAVC
GGLLRLASPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRA
MVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENL
VQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGM
NVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKI
IAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALG
TASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVL
DGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTS
VNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYA
AHNSVIVDECKVTLAANGKSADCSVEEEPWKREK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50004899
NameBDBM50004899
Synonyms:(1R,2S)-2-((S)-Amino-carboxy-methyl)-cyclopropanecarboxylic acid | 2-(Amino-carboxy-methyl)-cyclopropanecarboxylic acid (D-CGA-D) | CHEMBL285369 | L-CCG-I | L-CCG-IV
TypeSmall organic molecule
Emp. Form.C6H9NO4
Mol. Mass.159.14
SMILESN[C@@H]([C@H]1C[C@H]1C(O)=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a