Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCerebral cortex alpha adrenergic receptor
LigandBDBM50328483
Substrate/Competitorn/a
Meas. Tech.ChEMBL_665656
Ki 0.086±n/a nM
Citation Kristensen, JLPüschl, AJensen, MRisgaard, RChristoffersen, CTBang-Andersen, BBalle, T Exploring the neuroleptic substituent in octoclothepin: potential ligands for positron emission tomography with subnanomolar affinity fora(1)-adrenoceptors. J Med Chem53:7021-34 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cerebral cortex alpha adrenergic receptor
Name:Cerebral cortex alpha adrenergic receptor
Synonyms:Alpha 1A-adrenoceptor | Alpha 1A-adrenoreceptor | Alpha-1C adrenergic receptor | Cerebral cortex alpha adrenergic receptor | adrenergic Alpha1
Type:Enzyme Catalytic Domain
Mol. Mass.:51492.08
Organism:CALF
Description:adrenergic Alpha1 0 CALF
Residue:466
Sequence:
MVFLSGNASDSSNCTHPPPPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNVWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQKRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
AQVGGSGVTSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FRPSETVFKIAFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRKQSSKHTLGYTL
HAPSHVLEGQHKDLVRIPVGSAETFYKISKTDGVCEWKIFSSLPRGSARMAVARDPSACT
TARVRSKSFLQVCCCLGPSTPSHGENHQIPTIKIHTISLSENGEEV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50328483
NameBDBM50328483
Synonyms:1-Methyl-4-(8-(1-methyl-1H-1,2,4-triazol-3-yl)-10,11-dihydrodibenzo[b,f]thiepin-10-yl)piperazine | CHEMBL1258988
TypeSmall organic molecule
Emp. Form.C22H25N5S
Mol. Mass.391.532
SMILESCN1CCN(CC1)C1Cc2ccccc2Sc2ccc(cc12)-c1ncn(C)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a