Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha adrenergic receptor 1A and 1B
LigandBDBM50328499
Substrate/Competitorn/a
Meas. Tech.ChEMBL_665666
Ki 0.15±n/a nM
Citation Kristensen, JLPüschl, AJensen, MRisgaard, RChristoffersen, CTBang-Andersen, BBalle, T Exploring the neuroleptic substituent in octoclothepin: potential ligands for positron emission tomography with subnanomolar affinity fora(1)-adrenoceptors. J Med Chem53:7021-34 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha adrenergic receptor 1A and 1B
Name:Alpha adrenergic receptor 1A and 1B
Synonyms:Alpha 1B-adrenoceptor | Alpha 1B-adrenoreceptor | Alpha-1 Adrenergic Receptor | Alpha-1Adrenoceptor | Alpha-1B adrenergic receptor | Alpha-1B adrenoreceptor | adrenergic Alpha1B
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:56606.71
Organism:Rattus norvegicus (rat)
Description:Receptor binding assays were performed using rat cortical membranes.
Residue:515
Sequence:
MNPDLDTGHNTSAPAHWGELKDDNFTGPNQTSSNSTLPQLDVTRAISVGLVLGAFILFAI
VGNILVILSVACNRHLRTPTNYFIVNLAIADLLLSFTVLPFSATLEVLGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFM
RILGCQCRGGRRRRRRRRLGACAYTYRPWTRGGSLERSQSRKDSLDDSGSCMSGTQRTLP
SASPSPGYLGRGTQPPVELCAFPEWKPGALLSLPEPPGRRGRLDSGPLFTFKLLGDPESP
GTEGDTSNGGCDTTTDLANGQPGFKSNMPLAPGHF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50328499
NameBDBM50328499
Synonyms:1-Methyl-4-[8-(1-methyl-1H-tetrazol-5-ylmethyl)-10,11-dihydrodibenzo-[b,f]thiepin-10-yl]piperazine | CHEMBL1259129
TypeSmall organic molecule
Emp. Form.C22H26N6S
Mol. Mass.406.547
SMILESCN1CCN(CC1)C1Cc2ccccc2Sc2ccc(Cc3nnnn3C)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a