Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin S
LigandBDBM50328894
Substrate/Competitorn/a
Meas. Tech.ChEMBL_673955
IC50 16±n/a nM
Citation Rankovic, ZCai, JKerr, JFradera, XRobinson, JMistry, AFinlay, WMcGarry, GAndrews, FCaulfield, WCumming, IDempster, MWaller, JArbuckle, WAnderson, MMartin, IMitchell, ALong, CBaugh, MWestwood, PKinghorn, EJones, PUitdehaag, JCvan Zeeland, MPotin, DSaniere, LFouquet, AChevallier, FDeronzier, HDorleans, CNicolai, E Optimisation of 2-cyano-pyrimidine inhibitors of cathepsin K: improving selectivity over hERG. Bioorg Med Chem Lett20:6237-41 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin S
Name:Cathepsin S
Synonyms:CTSS | Cathepsin S (Cat S) | cathepsin S preproprotein
Type:Protein
Mol. Mass.:37507.38
Organism:Homo sapiens (Human)
Description:P25774
Residue:331
Sequence:
MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVM
LHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVD
WREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGC
NGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKE
AVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSW
GHNFGEEGYIRMARNKGNHCGIASFPSYPEI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50328894
NameBDBM50328894
Synonyms:2-(3-(2-cyano-6-(3-(trifluoromethyl)phenyl)pyrimidin-4-yl)propylamino)-2-methylpropanamide | CHEMBL1270269
TypeSmall organic molecule
Emp. Form.C19H20F3N5O
Mol. Mass.391.3902
SMILESCC(C)(NCCCc1cc(nc(n1)C#N)-c1cccc(c1)C(F)(F)F)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a