Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlycogen synthase kinase-3
LigandBDBM50329417
Substrate/Competitorn/a
Meas. Tech.ChEMBL_674071
IC50<1±n/a nM
Citation Menichincheri, MAlbanese, CAlli, CBallinari, DBargiotti, ACaldarelli, MCiavolella, ACirla, AColombo, MColotta, FCroci, VD'Alessio, RD'Anello, MErmoli, AFiorentini, FForte, BGalvani, AGiordano, PIsacchi, AMartina, KMolinari, AMoll, JKMontagnoli, AOrsini, POrzi, FPesenti, EPillan, ARoletto, FScolaro, ATatò, MTibolla, MValsasina, BVarasi, MVianello, PVolpi, DSantocanale, CVanotti, E Cdc7 kinase inhibitors: 5-heteroaryl-3-carboxamido-2-aryl pyrroles as potential antitumor agents. 1. Lead finding. J Med Chem53:7296-315 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glycogen synthase kinase-3
Name:Axin-1/Glycogen synthase kinase-3 beta
Synonyms:GSK-3 beta | GSK-3, beta | Glycogen synthase kinase 3 beta (GSK3β) | Glycogen synthase kinase 3-beta (GSK3β) | Glycogen synthase kinase-3 beta | Glycogen synthase kinase-3 beta (GSK-3B) | Glycogen synthase kinase-3 beta (GSK3 Beta) | Glycogen synthase kinase-3 beta (GSK3B) | Glycogen synthase kinase-3β (GSK-3β) | Glycogen synthase kinase-3beta (GSK3β)
Type:Enzyme
Mol. Mass.:46756.38
Organism:Homo sapiens (human)
Description:P49841
Residue:420
Sequence:
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
NFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50329417
n/a
NameBDBM50329417
Synonyms:5-(3-Fluoro-pyridin-4-yl)-2-phenyl-1H-pyrrole-3-carboxamide | CHEMBL1271441 | US9670191, E1
TypeSmall organic molecule
Emp. Form.C16H12FN3O
Mol. Mass.281.2844
SMILESNC(=O)c1cc([nH]c1-c1ccccc1)-c1ccncc1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: