Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlutamate receptor ionotropic AMPA
LigandBDBM50094024
Substrate/Competitorn/a
Meas. Tech.ChEMBL_684662
EC50 1660±n/a nM
Citation Grove, SJJamieson, CMaclean, JKMorrow, JARankovic, Z Positive allosteric modulators of thea-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor. J Med Chem53:7271-9 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glutamate receptor ionotropic AMPA
Name:Glutamate receptor ionotropic AMPA
Synonyms:AMPA-selective glutamate receptor 3 | GluR-3 | GluR-C | GluR-K3 | Glutamate receptor 3 | Glutamate receptor ionotropic, AMPA 3
Type:PROTEIN
Mol. Mass.:101172.14
Organism:Homo sapiens (Human)
Description:ChEMBL_468627
Residue:894
Sequence:
MARQKKMGQSVLRAVFFLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAFRFAVQLYNT
NQNTTEKPFHLNYHVDHLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSMNTLTSFCGAL
HTSFVTPSFPTDADVQFVIQMRPALKGAILSLLGHYKWEKFVYLYDTERGFSILQAIMEA
AVQNNWQVTARSVGNIKDVQEFRRIIEEMDRRQEKRYLIDCEVERINTILEQVVILGKHS
RGYHYMLANLGFTDILLERVMHGGANITGFQIVNNENPMVQQFIQRWVRLDEREFPEAKN
APLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQGIDIERALKM
VQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDSASS
ENRTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKY
GARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKS
KPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLEDNNEEPRDPQSPPDPP
NEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVER
MVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTAD
GVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRNAVNL
AVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMM
VALIEFCYKSRAESKRMKLTKNTQNFKPAPATNTQNYATYREGYNVYGTESVKI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50094024
NameBDBM50094024
Synonyms:(+/-) Propane-2-sulfonic acid [2-(4'-cyano-biphenyl-4-yl)-propyl]-amide | CHEMBL435582 | propane-2-sulfonic acid [2-(4'-cyano-biphenyl-4-yl)-propyl]-amide
TypeSmall organic molecule
Emp. Form.C19H22N2O2S
Mol. Mass.342.455
SMILESCC(C)S(=O)(=O)NCC(C)c1ccc(cc1)-c1ccc(cc1)C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a