Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase Aurora-C
LigandBDBM50331612
Substrate/Competitorn/a
Meas. Tech.ChEMBL_687468
Ki>1000000±n/a nM
Citation Krug, MErlenkamp, GSippl, WSchächtele, CTotzke, FHilgeroth, A Discovery and selectivity-profiling of 4-benzylamino 1-aza-9-oxafluorene derivatives as lead structures for IGF-1R inhibitors. Bioorg Med Chem Lett20:6915-9 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase Aurora-C
Name:Serine/threonine-protein kinase Aurora-C
Synonyms:Aurora kinase C | Aurora kinase C (AURKC) | Aurora-C | Aurora/Ipl1-related kinase 3 | Aurora/Ipl1/Eg2 protein 2 | Serine/threonine-protein kinase 13
Type:Enzyme
Mol. Mass.:35602.43
Organism:Homo sapiens (Human)
Description:Amino acid residues 1-309 were expressed as His-tagged fusion protein using baculovirus expression system.
Residue:309
Sequence:
MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLA
RLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLIL
EYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEV
KIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFE
SASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRV
LPPCAQMAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50331612
NameBDBM50331612
Synonyms:CHEMBL1290072 | N-(4-methoxybenzyl)benzofuro[2,3-b]pyridin-4-amine
TypeSmall organic molecule
Emp. Form.C19H16N2O2
Mol. Mass.304.3425
SMILESCOc1ccc(CNc2ccnc3oc4ccccc4c23)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a