Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetChymase
LigandBDBM50332961
Substrate/Competitorn/a
Meas. Tech.ChEMBL_696202
IC50 0.46±n/a nM
Citation Mehta, PDSengar, NPPathak, AK 2-Azetidinone--a new profile of various pharmacological activities. Eur J Med Chem45:5541-60 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Chymase
Name:Chymase
Synonyms:Alpha-chymase | Chymase precursor | Mast cell protease I
Type:Enzyme
Mol. Mass.:27340.12
Organism:Homo sapiens (Human)
Description:n/a
Residue:247
Sequence:
MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNF
VLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKA
SLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRD
FDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWI
NQILQAN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50332961
NameBDBM50332961
Synonyms:(3S,4S)-3-Benzyl-4-(4-methylpiperazincarbonyl)phenoxy-1-[(R)-1-(phenylethyl)aminocarbonyl]azetidin-2-one | CHEMBL1631751
TypeSmall organic molecule
Emp. Form.C30H34N4O3
Mol. Mass.498.616
SMILESC[C@@H](NC(=O)N1[C@H](Oc2ccc(cc2)N2CCN(C)CC2)[C@H](Cc2ccccc2)C1=O)c1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a