Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-2A adrenergic receptor
LigandBDBM50271255
Substrate/Competitorn/a
Meas. Tech.ChEMBL_698563
EC50 160±n/a nM
Citation Saczewski, FKornicka, AHudson, ALLaird, SScheinin, MLaurila, JMRybczynska, ABoblewski, KLehmann, AGdaniec, M 3-[(Imidazolidin-2-yl)imino]indazole ligands with selectivity for thea(2)-adrenoceptor compared to the imidazoline I(1) receptor. Bioorg Med Chem19:321-9 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-2A adrenergic receptor
Name:Adenosine receptor A1/Alpha-2A adrenergic receptor
Synonyms:Adrenergic alpha2A | Adrenergic receptor alpha | Alpha-2 adrenergic receptor subtype C10 | Alpha-2A adrenoceptor | Alpha-2A adrenoreceptor | Alpha-2AAR | alpha-2A adrenergic receptor [Homo sapiens]
Type:Enzyme
Mol. Mass.:48979.91
Organism:Homo sapiens (Human)
Description:P08913
Residue:450
Sequence:
MGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLLTVFGNVLVIIAVFT
SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSS
IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIITVWVISAVISFPPLISIEKKGGGGG
PQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDAVA
APPGGTERRPNGLGPERSAGPGGAEAEPLPTQLNGAPGEPAPAGPRDTDALDLEESSSSD
HAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGATGIGTPAAGPGEERVGAAKAS
RWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPRTLFKFFFWFGYCNSS
LNPVIYTIFNHDFRRAFKKILCRGDRKRIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50271255
NameBDBM50271255
Synonyms:1-[(Imidazolidin-2-yl)imino]indazole hydrochloride | CHEMBL1186220 | CHEMBL454712
TypeSmall organic molecule
Emp. Form.C10H11N5
Mol. Mass.201.2278
SMILES[#6]-1-[#6]-[#7]\[#6](-[#7]-1)=[#7]/n1ncc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a