Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin (5-HT) receptor
LigandBDBM50334528
Substrate/Competitorn/a
Meas. Tech.ChEMBL_701285
Ki 45±n/a nM
Citation Rudolph, DADvorak, CADvorak, LNepomuceno, DBonaventure, PLovenberg, TWCarruthers, NI Novel tetrahydropyrido[3,2-c]pyrroles as 5-HT(7) antagonists. Bioorg Med Chem Lett21:42-4 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin (5-HT) receptor
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-7 | 5-HT-X | 5-HT7 | 5-HT7L | 5-HT7S | 5-Hydroxytryptamine receptor 7 (5-HT7) | 5-hydroxytryptamine receptor 7 | 5-hydroxytryptamine receptor 7 (5-HT-7) | Adrenergic Alpha | GPRFO | HTR7 | Serotonin Receptor 7
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:49852.62
Organism:Rattus norvegicus (rat)
Description:Rat cloned 5-HT7R.
Residue:448
Sequence:
MMDVNSSGRPDLYGHLRSLILPEVGRGLQDLSPDGGAHPVVSSWMPHLLSGFLEVTASPA
PTWDAPPDNVSGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSN
YLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVIS
IDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDF
GYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVQPESVISLNGVVKLQK
EVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTS
CSCIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHE
ALKLAERPERSEFVLQNSDHCGKKGHDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50334528
NameBDBM50334528
Synonyms:1-benzyl-3-(4-fluorophenyl)-4,5,6,7-tetrahydro-1H-pyrrolo[3,2-c]pyridine | CHEMBL1644279
TypeSmall organic molecule
Emp. Form.C20H19FN2
Mol. Mass.306.3767
SMILESFc1ccc(cc1)-c1cn(Cc2ccccc2)c2CCNCc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a