Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetType-1 angiotensin II receptor
LigandBDBM50003387
Substrate/Competitorn/a
Meas. Tech.ChEMBL_717480
IC50 30±n/a nM
Citation Naik, PMurumkar, PGiridhar, RYadav, MR Angiotensin II receptor type 1 (AT1) selective nonpeptidic antagonists--a perspective. Bioorg Med Chem18:8418-56 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Type-1 angiotensin II receptor
Name:Type-1 angiotensin II receptor
Synonyms:AT1 | Angiotensin II type-1 receptor
Type:PROTEIN
Mol. Mass.:41004.19
Organism:Cavia porcellus
Description:ChEMBL_36783
Residue:359
Sequence:
MILNSSTEDGIKRIQDDCPKAGRHSYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADICFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCVIIWLMAGLASLPAVIHRNVFFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFMFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFK
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIHDCKISDIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPKAKSHSTLSTKMSTLSYRPSDNVSSSAKKPVQCFEVE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50003387
NameBDBM50003387
Synonyms:2-Ethyl-4-[2'-(1H-tetrazol-5-yl)-biphenyl-4-ylmethoxy]-quinoline | 2-Ethyl-4-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethoxy]-quinoline | CHEMBL284536 | ZD-8731
TypeSmall organic molecule
Emp. Form.C25H21N5O
Mol. Mass.407.4671
SMILESCCc1cc(OCc2ccc(cc2)-c2ccccc2-c2nnn[nH]2)c2ccccc2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a